PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018479.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 627aa    MW: 68945.9 Da    PI: 5.1899
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018479.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS316.94.2e-972676252374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  +++L+++Ae +++g+  laq +Larl+++ sp g+p+ R a+yf+eAL+  l+  ++s++++al+p      + + ++ a+k fse+sP+++f+++t+
  Pbr018479.1 267 IDQLFNAAELIETGNSVLAQGILARLNHQLSPIGKPFSRTAFYFKEALQFLLNTnTSSNCSSALSP-----FSLIFKIGAYKSFSEISPVVQFANFTC 359
                  689*************************************************99333444444333.....3479*********************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaIleaveg +rvH+iDfdi++G+QW++++q+ a R++g psl+iT++ s++++++ e++ t+e+L++fA+el++ fe +++   +le+l+  +L +
  Pbr018479.1 360 NQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALRNGGVPSLKITAFISSSTHDEFEVSFTRENLKHFATELNLAFELELV---SLEALNSGSLGL 454
                  ***************************************************9*9****************************8...788888888765 PP

         GRAS 197 kp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                       E +aV + l + ++ ++++sl+     +L++vk+lsP++vv  ++ +d+++ +F +++++al+ ys l++s++a    + ++ +k+Er ll++
  Pbr018479.1 455 PLhaSEGVAVAVNLPIGSFSNNPLSLPL----ILRFVKQLSPRIVVSLDRGSDRTDLPFPHQIIQALYSYSGLLESIDAA-NVNPDALQKIERYLLQP 547
                  4444888888888888999999999999....*********************************************665.34668999********* PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   i+++v+  +       ++  +Wr  + ++GF+p+++s+++++qa++l++++++ g+++e+++ slvl+W+ + L+s+SaWr
  Pbr018479.1 548 GIEKIVTGCHLL----PKRTPSWRTLFLSSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKRQSSLVLCWQCKDLISASAWR 625
                  ******988887....89999************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.892240605IPR005202Transcription factor GRAS
PfamPF035141.5E-94267625IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MEDWESVLSE SPGQEQSILR LIMSDIEDPS LGLNTLLQSS SGSDHLHQDL EFSGGGFQDG  60
VDQGGYGGVF EPNNNSGSLV SPSLHASSGP DFNFSNNASN VETRSSNVRP NPAIFSASMS  120
NPFLVSQSSG MFQQQQSMGL DEKPQIFNPQ MVINQNQAQF AQYPAMFMPL TYAQLQEHHL  180
LSPPPSKRLN SGELGPSYPV QSVPFSNPGQ ELVVRAQQQL QFLPQHLQQQ RPTMPVAKEK  240
MMSPAEGCKE MMNQNQLQQQ QFQQAVIDQL FNAAELIETG NSVLAQGILA RLNHQLSPIG  300
KPFSRTAFYF KEALQFLLNT NTSSNCSSAL SPFSLIFKIG AYKSFSEISP VVQFANFTCN  360
QAILEAVEGF NRVHVIDFDI GYGGQWASFM QEVALRNGGV PSLKITAFIS SSTHDEFEVS  420
FTRENLKHFA TELNLAFELE LVSLEALNSG SLGLPLHASE GVAVAVNLPI GSFSNNPLSL  480
PLILRFVKQL SPRIVVSLDR GSDRTDLPFP HQIIQALYSY SGLLESIDAA NVNPDALQKI  540
ERYLLQPGIE KIVTGCHLLP KRTPSWRTLF LSSGFSPLTF SNFTESQAEC LVQRTPVGGF  600
HIEKRQSSLV LCWQCKDLIS ASAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2828462521375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375779.10.0PREDICTED: scarecrow-like protein 22
SwissprotO813161e-142SCL6_ARATH; Scarecrow-like protein 6
TrEMBLM5X7H70.0M5X7H7_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF31833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-139GRAS family protein